lonza nucleofection buffer (Lonza)
Lonza is a verified supplier 
Lonza manufactures this product 
90
Structured Review
Lonza
lonza nucleofection buffer
Lonza Nucleofection Buffer, supplied by Lonza, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/nucleofection+buffer/lonza+nucleofection+buffer/bio_rxiv__2025__07__16__664824-218-21-21
Average 90 stars, based on 1 article reviews
Lonza Nucleofection Buffer, supplied by Lonza, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/nucleofection+buffer/lonza+nucleofection+buffer/bio_rxiv__2025__07__16__664824-218-21-21
Average 90 stars, based on 1 article reviews
lonza nucleofection buffer - by Bioz Stars,
2026-10
90/100 stars
Images
Related Articles
Allele-specific Oligonucleotide:Article Title: ASO-mediated knock-down of GPNMB in mutant- GRN and in Grn -deficient peripheral myeloid cells disrupts lysosomal function and immune responses Article Snippet: .. Supernatant was carefully aspirated so not to disturb the cell pellet, and cells resuspended in Control:Article Title: ASO-mediated knock-down of GPNMB in mutant- GRN and in Grn -deficient peripheral myeloid cells disrupts lysosomal function and immune responses Article Snippet: .. Supernatant was carefully aspirated so not to disturb the cell pellet, and cells resuspended in Concentration Assay:Article Title: ASO-mediated knock-down of GPNMB in mutant- GRN and in Grn -deficient peripheral myeloid cells disrupts lysosomal function and immune responses Article Snippet: .. Supernatant was carefully aspirated so not to disturb the cell pellet, and cells resuspended in Plasmid Preparation:Article Title: AMPK stimulation inhibits YAP/TAZ signaling to ameliorate hepatic fibrosis Article Snippet: .. Briefly, 5.0 × 10^5 HSCs (per reaction) were resuspended in 100 μl of CRISPR:Article Title: PILRA regulates microglial neuroinflammation and lipid metabolism as a candidate therapeutic target for Alzheimer’s disease Article Snippet: 513 CRISPR/Cas9 generation of PILRA KO - iPSC line 2 514 WTC11-mEGFP (Coriell, AICS-0036-006) iPSCs were collected following Accutase 515 (07920; STEMCELL Technologies) enzymatic digestion for 3 min at 37°C. .. 250,000 cells 516 were resuspended in 100μl Construct:Article Title: Harnessing human iPSC-microglia for CNS-wide delivery of disease-modifying proteins. Article Snippet: .. The CD9sNEP template construct was similarly designed by replacing the initial 51-aa peptide sequence of neprilysin (MGKSESQMDITDINT PKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYAT) with the 29-aa Angiotensin-converting enzyme secretion signal (MGAASGRRGP GLLLPLPLLLLLPPQPALA) (Figure S2B). iPSCs were collected following Accutase enzymatic digestion for 3 min at 37 C. 250,000 cells were resuspended in a 100 mL Sequencing:Article Title: Harnessing human iPSC-microglia for CNS-wide delivery of disease-modifying proteins. Article Snippet: .. The CD9sNEP template construct was similarly designed by replacing the initial 51-aa peptide sequence of neprilysin (MGKSESQMDITDINT PKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYAT) with the 29-aa Angiotensin-converting enzyme secretion signal (MGAASGRRGP GLLLPLPLLLLLPPQPALA) (Figure S2B). iPSCs were collected following Accutase enzymatic digestion for 3 min at 37 C. 250,000 cells were resuspended in a 100 mL |